PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr5P06590_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family MIKC_MADS
Protein Properties Length: 175aa    MW: 20213.5 Da    PI: 10.3022
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr5P06590_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF99.21.6e-31959151
                           S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
                 SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                           krien++nrqvtf+kRrng+lKKA+ELSvLCdaeva+++fss+g+lyey++
  GSMUA_Achr5P06590_001  9 KRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALVVFSSRGRLYEYAT 59
                           79***********************************************86 PP

2K-box82.21.2e-2782146973
                  K-box   9 leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnell 73 
                             +e +a+++qqe++kL ++i+nLq+++R+l+Ge+L+s+sl++L+qLe++Lek+++kiR+kK +l+
  GSMUA_Achr5P06590_001  82 PSEGNAQYYQQEASKLHQQINNLQSTNRNLMGESLNSMSLRDLKQLETRLEKGINKIRTKKANLF 146
                            67889********************************************************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004328.8E-43160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006634.258161IPR002100Transcription factor, MADS-box
SuperFamilySSF554554.06E-33274IPR002100Transcription factor, MADS-box
CDDcd002653.69E-44275No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004043.7E-33323IPR002100Transcription factor, MADS-box
PfamPF003195.7E-271057IPR002100Transcription factor, MADS-box
PRINTSPR004043.7E-332338IPR002100Transcription factor, MADS-box
PRINTSPR004043.7E-333859IPR002100Transcription factor, MADS-box
PfamPF014862.2E-2186146IPR002487Transcription factor, K-box
PROSITE profilePS5129710.5187175IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 175 aa     Download sequence    Send to blast
MGRGKIEIKR IENTTNRQVT FCKRRNGLLK KAYELSVLCD AEVALVVFSS RGRLYEYATS  60
SVKESIERYK KACSDTTNTG FPSEGNAQYY QQEASKLHQQ INNLQSTNRN LMGESLNSMS  120
LRDLKQLETR LEKGINKIRT KKANLFKLCA NLFAIRIMCF YYLHGLFKKM LIPHI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P1e-21169169Myocyte-specific enhancer factor 2B
1tqe_Q1e-21169169Myocyte-specific enhancer factor 2B
1tqe_R1e-21169169Myocyte-specific enhancer factor 2B
1tqe_S1e-21169169Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009399817.11e-100PREDICTED: MADS-box transcription factor 3-like
SwissprotQ435853e-80AG_TOBAC; Floral homeotic protein AGAMOUS
TrEMBLM0SW881e-128M0SW88_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr5P06590_0011e-127(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP64937144
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G09960.45e-77MIKC_MADS family protein